▷ Poshmommyjewelry.com : POSH Mommy Jewelry | Mom Jewelry, Personalized Mom Necklace

Poshmommyjewelry Meta Tags

Title	POSH Mommy Jewelry \| Mom Jewelry, Personalized Mom Necklace
Description	POSH Mommy offers luxurious, everyday jewelry for mommies with style. The line’s engravable discs, loops, circles, mini dog tags, tall tags and hearts are made in sterling sliver, gold, or white gold, and can be customized with a birthstone and backstamped with dates or messages. Business savvy coupled with fashion by founder Ali Krebs, POSH Mommy has become the staple accessory for moms from Hollywood and beyond (Brooke Burke, Kimberly Quaid, Milla Jovovich, Garcelle Beauvais and others are fans). POSH Mommy gives moms the chance to show off their kids in style, whether they’re at the playground or out for date night.
Keywords	Swank Mommy, Hip Mommy Jewelry, Personalized Mom Necklace, Silver Name Charm Necklace, Customized Mom's Necklace, Neck Charms for Mom, Handcrafted Mom Necklace, Birthstone Necklace, Handmade Mom's Necklace with Chlld's birthdate and birthstone, Custom Mom's Necklace, Mother's Pendants, Mom and Baby Jewelry, Engraved Mothers Necklace, Sterling Silver Mothers Necklace, Mom Necklace Charm, Personalized Mom's Necklaces, Mom Name Charm Necklace, Handcrafted Mom Neck Charms, Mommy Jewelry, Mommy Necklace,

Websites to explore

paswjoomla.net

gbi-bethel.org

tampapoolrestorations.com

meble-bogart.pl

noandnoart.com

nymg.com.hk

ilashqueenstore.com

pccwireless.com

rosemarywhitepediatricservices.com

exceldepartment.com

Poshmommyjewelry.com Summary

Poshmommyjewelry.com was created 14 years ago. Web server is located in United States and has an IP address 13.227.222.56.

Poshmommyjewelry com Info

Creation date	2010-04-22
Expiration date	2021-04-22
Registrar	GoDaddy.com, LLC
Name servers	ns-1671.awsdns-16.co.uk ns-1087.awsdns-07.org ns-672.awsdns-20.net ns-467.awsdns-58.com
IP address	13.227.222.56
Server located	United States
Host name	server-13-227-222-56.ams54.r.cloudfront.net

Alexa Traffic Ranks

Global Rank	n/a
Delta (90 Days)	n/a
Most Popular In Country	n/a
Country Rank	n/a

DNS

Host	Type	TTL	Data
poshmommyjewelry.com	A	60	ip: 13.227.222.56
poshmommyjewelry.com	A	60	ip: 13.227.222.127
poshmommyjewelry.com	A	60	ip: 13.227.222.90
poshmommyjewelry.com	A	60	ip: 13.227.222.59
poshmommyjewelry.com	MX	1200	pri: 0 target: poshmommyjewelry-com.mail.protection.outlook.com
poshmommyjewelry.com	NS	172800	target: ns-1087.awsdns-07.org
poshmommyjewelry.com	NS	172800	target: ns-1671.awsdns-16.co.uk
poshmommyjewelry.com	NS	172800	target: ns-467.awsdns-58.com
poshmommyjewelry.com	NS	172800	target: ns-672.awsdns-20.net
poshmommyjewelry.com	SOA	900	mname: ns-1671.awsdns-16.co.uk rname: awsdns-hostmaster.amazon.com serial: 1 refresh: 7200 retry: 900 expire: 1209600 minimum-ttl: 86400
poshmommyjewelry.com	TXT	3600	txt: v=spf1 include:spf.protection.outlook.com -all

HTTP Headers

Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Server: nginx
Date: Mon, 30 Nov 2020 03:15:05 GMT
Vary: Accept-Encoding
X-Powered-By: PHP/5.6.40
Set-Cookie: frontend=dfd0701d4a5a7ef77154b029db718527; expires=Mon, 30-Nov-2020 04:15:04 GMT; Max-Age=3600; path=/; domain=poshmommyjewelry.com; HttpOnly
Set-Cookie: frontend_cid=vi2mDhHo0yYBmEnb; expires=Mon, 30-Nov-2020 04:15:04 GMT; Max-Age=3600; path=/; domain=poshmommyjewelry.com; secure; httponly
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Frame-Options: SAMEORIGIN
Access-Control-Allow-Origin: *
X-Cache: Miss from cloudfront
Via: 1.1 1ec0bb05703028c61e280acc1eda60ce.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: LHR50-C1
X-Amz-Cf-Id: 81oxYpziSxzD94ZlmOZc86-JS_QHJQjGFqtlLBUObpHUBHPMED7ygA==
x-encoded-content-encoding: gzip

poshmommyjewelry.com Whois

Domain Name: POSHMOMMYJEWELRY.COM
Registry Domain ID: 1593797704_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-04-22T14:33:38Z
Creation Date: 2010-04-22T01:06:24Z
Registrar Registration Expiration Date: 2021-04-22T01:06:24Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: POSH Mommy
Registrant State/Province: Illinois
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=POSHMOMMYJEWELRY.COM
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=POSHMOMMYJEWELRY.COM
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=POSHMOMMYJEWELRY.COM
Name Server: NS-1671.AWSDNS-16.CO.UK
Name Server: NS-1087.AWSDNS-07.ORG
Name Server: NS-672.AWSDNS-20.NET
Name Server: NS-467.AWSDNS-58.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/